PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0063s0610.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 249aa    MW: 28442.4 Da    PI: 10.2809
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0063s0610.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.23.2e-53101351128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                             lppGfrFhPtdeel+v+yL+++++++++++ ++i+e+diyk++Pw+Lp+k++ +e+ewyfF++ d+ky++g r+nrat sgyWkatg
  SapurV1A.0063s0610.1.p  10 LPPGFRFHPTDEELIVYYLRNQATSRPCPA-SIIPEFDIYKFDPWQLPEKAEFGENEWYFFTPLDRKYPNGVRPNRATVSGYWKATG 95 
                             79****************************.89***************99999********************************** PP

                     NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             +dk+++s +++ vg+kk Lvfykgr pkg+ktdW+m+eyrl
  SapurV1A.0063s0610.1.p  96 TDKAIHS-GSKYVGVKKALVFYKGRPPKGTKTDWIMQEYRL 135
                             *******.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.5E-629159IPR003441NAC domain
PROSITE profilePS5100558.21610159IPR003441NAC domain
PfamPF023654.1E-2611135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MQGKNNSGQL PPGFRFHPTD EELIVYYLRN QATSRPCPAS IIPEFDIYKF DPWQLPEKAE  60
FGENEWYFFT PLDRKYPNGV RPNRATVSGY WKATGTDKAI HSGSKYVGVK KALVFYKGRP  120
PKGTKTDWIM QEYRLNDSNK QAIKQKGSMR LVLCRIYRKR HAMRHLDEKT ENTVLAHLEV  180
TPATDAREQQ MMKIPRTCSI SQLLELDYLG SISQLLSGDT RKKQKKKGGR TRATHGGQSS  240
RPQCNESA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-621016217168NO APICAL MERISTEM PROTEIN
1ut4_B3e-621016217168NO APICAL MERISTEM PROTEIN
1ut7_A3e-621016217168NO APICAL MERISTEM PROTEIN
1ut7_B3e-621016217168NO APICAL MERISTEM PROTEIN
3swm_A3e-621016220171NAC domain-containing protein 19
3swm_B3e-621016220171NAC domain-containing protein 19
3swm_C3e-621016220171NAC domain-containing protein 19
3swm_D3e-621016220171NAC domain-containing protein 19
3swp_A3e-621016220171NAC domain-containing protein 19
3swp_B3e-621016220171NAC domain-containing protein 19
3swp_C3e-621016220171NAC domain-containing protein 19
3swp_D3e-621016220171NAC domain-containing protein 19
4dul_A3e-621016217168NAC domain-containing protein 19
4dul_B3e-621016217168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1827091e-122AC182709.2 Populus trichocarpa clone Pop1-85D11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002315038.11e-150hypothetical protein POPTR_0010s17350g
SwissprotO492551e-107NAC29_ARATH; NAC transcription factor 29
TrEMBLB9HXY01e-150B9HXY0_POPTR; Uncharacterized protein
STRINGPOPTR_0010s17350.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41033262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-108NAC-like, activated by AP3/PI